Lineage for d6jc0b_ (6jc0 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552293Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2552307Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2552308Protein automated matches [191185] (6 species)
    not a true protein
  7. 2552323Species Mycobacterium smegmatis [TaxId:246196] [364854] (1 PDB entry)
  8. 2552324Domain d6jc0b_: 6jc0 B: [364855]
    automated match to d2wp4a_

Details for d6jc0b_

PDB Entry: 6jc0 (more details), 2.1 Å

PDB Description: structural analysis of molybdopterin synthases from two mycobacteria pathogens
PDB Compounds: (B:) Putative molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d6jc0b_:

Sequence, based on SEQRES records: (download)

>d6jc0b_ d.41.5.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
saeivrveltedpislteyealvaheaagavvgfagvvrdhdggrsvlrleysahptaqr
tleevaeeiaaqsdgvraiavshrigplkigdaalvaavaadhrraafetcarlvdvvke
rlpvwkhqhfadgtdewvns

Sequence, based on observed residues (ATOM records): (download)

>d6jc0b_ d.41.5.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
saeivrveltedpislteyealvaagavvgfagvvrdhdggrsvlrleysahptaqrtle
evaeeiaaqsdgvraiavshrigplkigdaalvaavaadhrraafetcarlvdvvkerlp
vwkhqhfadgtdewvns

SCOPe Domain Coordinates for d6jc0b_:

Click to download the PDB-style file with coordinates for d6jc0b_.
(The format of our PDB-style files is described here.)

Timeline for d6jc0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6jc0d_