SCOPe 2.07: Domain d6e5la1: 6e5l A:1-134

Lineage for d6e5la1 (6e5l A:1-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d6e5la1: 6e5l A:1-134 [364818]
   Other proteins in same PDB: d6e5la2
   automated match to d5ljha_
   complexed with hvd

Details for d6e5la1

PDB Entry: 6e5l, 1.17 Å

PDB Description: crystal structure of human cellular retinol binding protein 1 in complex with abnormal-cannabidiol (abn-cbd)

PDB Compounds: (A:) Retinol-binding protein 1

SCOPe Domain Sequences for d6e5la1:

Sequence; same for both SEQRES and ATOM records:

>d6e5la1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvq

Timeline for d6e5la1:

• d6e5la1 is new in SCOPe 2.07-stable
  
• d6e5la1 appears in the current release, SCOPe 2.08