PDB entry 6e5l

View 6e5l on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 1 in complex with abnormal-cannabidiol (abn-CBD)
Class: lipid binding protein
Keywords: vitamin A, retinol, abn-CBD, abnormal cannabidiol, LIPID BINDING PROTEIN
Deposited on 2018-07-20, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP1, CRBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09455 (0-133)
      • expression tag (134-139)
    Domains in SCOPe 2.07: d6e5la1, d6e5la2
  • Heterogens: HVD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e5lA (A:)
    pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
    imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
    vegvvckqvfkkvqhhhhhh