Lineage for d1tay__ (1tay -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (14 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (174 PDB entries) 
Domain d1tay__: 1tay - [36459]
Details for d1tay__
PDB Entry: 1tay (more details), 1.7 Å
PDB Description: dissection of the functional role of structural elements of tyrosine- 63 in the catalytic action of human lysozyme
SCOP Domain Sequences for d1tay__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tay__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srawcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1tay__:
Click to download the PDB-style file with coordinates for d1tay__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tay__:
- d1tay__ first appeared (with stable ids) in SCOP 1.55
- d1tay__ appears in SCOP 1.59
- d1tay__ appears in the current release, SCOPe 2.08, called d1taya_
View in 3D