Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hw7h_: 6hw7 H: [364199] Other proteins in same PDB: d6hw7a_, d6hw7b_, d6hw7c_, d6hw7d_, d6hw7e_, d6hw7f_, d6hw7g_, d6hw7i_, d6hw7j_, d6hw7k_, d6hw7l_, d6hw7n_, d6hw7o_, d6hw7p_, d6hw7q_, d6hw7r_, d6hw7s_, d6hw7t_, d6hw7u_, d6hw7w_, d6hw7x_, d6hw7y_, d6hw7z_ automated match to d5fg9h_ complexed with cl, gtw, mg |
PDB Entry: 6hw7 (more details), 2.7 Å
SCOPe Domain Sequences for d6hw7h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw7h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hw7h_: