Lineage for d6hwfh_ (6hwf H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600374Domain d6hwfh_: 6hwf H: [363931]
    Other proteins in same PDB: d6hwfa_, d6hwfb_, d6hwfc_, d6hwfd_, d6hwfe_, d6hwff_, d6hwfg_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfn_, d6hwfo_, d6hwfp_, d6hwfq_, d6hwfr_, d6hwfs_, d6hwft_, d6hwfu_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_
    automated match to d5fg9h_
    complexed with cl, gqk, mes, mg, so4; mutant

Details for d6hwfh_

PDB Entry: 6hwf (more details), 2.5 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with onx 0914
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hwfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwfh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcaaagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6hwfh_:

Click to download the PDB-style file with coordinates for d6hwfh_.
(The format of our PDB-style files is described here.)

Timeline for d6hwfh_: