Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hwfh_: 6hwf H: [363931] Other proteins in same PDB: d6hwfa_, d6hwfb_, d6hwfc_, d6hwfd_, d6hwfe_, d6hwff_, d6hwfg_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfn_, d6hwfo_, d6hwfp_, d6hwfq_, d6hwfr_, d6hwfs_, d6hwft_, d6hwfu_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_ automated match to d5fg9h_ complexed with cl, gqk, mes, mg, so4; mutant |
PDB Entry: 6hwf (more details), 2.5 Å
SCOPe Domain Sequences for d6hwfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwfh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcaaagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d6hwfh_: