Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hvxv_: 6hvx V: [363598] Other proteins in same PDB: d6hvxb_, d6hvxc_, d6hvxd_, d6hvxe_, d6hvxf_, d6hvxg_, d6hvxi_, d6hvxj_, d6hvxk_, d6hvxl_, d6hvxn_, d6hvxo_, d6hvxp_, d6hvxq_, d6hvxr_, d6hvxs_, d6hvxt_, d6hvxu_, d6hvxw_, d6hvxx_, d6hvxy_, d6hvxz_ automated match to d5fg9h_ complexed with cl, gqh, mg |
PDB Entry: 6hvx (more details), 2.8 Å
SCOPe Domain Sequences for d6hvxv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvxv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6hvxv_: