Lineage for d6hvxv_ (6hvx V:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600984Domain d6hvxv_: 6hvx V: [363598]
    Other proteins in same PDB: d6hvxb_, d6hvxc_, d6hvxd_, d6hvxe_, d6hvxf_, d6hvxg_, d6hvxi_, d6hvxj_, d6hvxk_, d6hvxl_, d6hvxn_, d6hvxo_, d6hvxp_, d6hvxq_, d6hvxr_, d6hvxs_, d6hvxt_, d6hvxu_, d6hvxw_, d6hvxx_, d6hvxy_, d6hvxz_
    automated match to d5fg9h_
    complexed with cl, gqh, mg

Details for d6hvxv_

PDB Entry: 6hvx (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 4
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hvxv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvxv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d6hvxv_:

Click to download the PDB-style file with coordinates for d6hvxv_.
(The format of our PDB-style files is described here.)

Timeline for d6hvxv_: