Lineage for d6fp6q_ (6fp6 Q:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373801Species Human (Homo sapiens) [TaxId:9606] [49333] (95 PDB entries)
  8. 2374242Domain d6fp6q_: 6fp6 Q: [363316]
    Other proteins in same PDB: d6fp6v_
    automated match to d4mcma_
    complexed with gol, ppi, zn

Details for d6fp6q_

PDB Entry: 6fp6 (more details), 3 Å

PDB Description: complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation
PDB Compounds: (Q:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d6fp6q_:

Sequence, based on SEQRES records: (download)

>d6fp6q_ b.1.8.1 (Q:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlaagvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d6fp6q_ b.1.8.1 (Q:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadgvadvsiedsvislsgdhciigrtlvvhek
addlgkggneestktgnagsrlaagvigiaq

SCOPe Domain Coordinates for d6fp6q_:

Click to download the PDB-style file with coordinates for d6fp6q_.
(The format of our PDB-style files is described here.)

Timeline for d6fp6q_: