Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [49333] (95 PDB entries) |
Domain d6fp6o_: 6fp6 O: [363221] Other proteins in same PDB: d6fp6v_ automated match to d4mcma_ complexed with gol, ppi, zn |
PDB Entry: 6fp6 (more details), 3 Å
SCOPe Domain Sequences for d6fp6o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fp6o_ b.1.8.1 (O:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh ekaddlgkggneestktgnagsrlaagvigiaq
Timeline for d6fp6o_: