Lineage for d6c6ja2 (6c6j A:186-279)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370060Domain d6c6ja2: 6c6j A:186-279 [363114]
    Other proteins in same PDB: d6c6ja1, d6c6jb_
    automated match to d1zt4c1
    complexed with bma, fuc, j76, man, nag, plm

Details for d6c6ja2

PDB Entry: 6c6j (more details), 1.79 Å

PDB Description: structure of glycolipid agsa[8,p5p] in complex with mouse cd1d
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6c6ja2:

Sequence, based on SEQRES records: (download)

>d6c6ja2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d6c6ja2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvphrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat
ldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d6c6ja2:

Click to download the PDB-style file with coordinates for d6c6ja2.
(The format of our PDB-style files is described here.)

Timeline for d6c6ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c6ja1
View in 3D
Domains from other chains:
(mouse over for more information)
d6c6jb_