SCOPe 2.07: Domain d6cjpb_: 6cjp B:

Lineage for d6cjpb_ (6cjp B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [363057] (6 PDB entries)

8. Domain d6cjpb_: 6cjp B: [363058]
   Other proteins in same PDB: d6cjpa2
   automated match to d4xkaa_
   complexed with f5s

Details for d6cjpb_

PDB Entry: 6cjp, 2.6 Å

PDB Description: candida albicans hsp90 nucleotide binding domain in complex with radicicol

PDB Compounds: (B:) Heat shock protein 90 homolog

SCOPe Domain Sequences for d6cjpb_:

Sequence, based on SEQRES records:

>d6cjpb_ d.122.1.1 (B:) automated matches {Candida albicans [TaxId: 237561]}
taeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelfiriip
qkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvgfyslf
lvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedqleyleek
rikevvkkhsefvaypiqlvvtkeve

Sequence, based on observed residues (ATOM records):

>d6cjpb_ d.122.1.1 (B:) automated matches {Candida albicans [TaxId: 237561]}
taeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelfiriip
qkdqkvleirdsgigmtkadlvnnlgtiakfgvgfyslflvadhvqviskhnddeqyvwe
snaggkftvtldetnerlgrgtmlrlflkedqleyleekrikevvkkhsefvaypiqlvv
tkeve

Timeline for d6cjpb_:

• d6cjpb_ is new in SCOPe 2.07-stable
  
• d6cjpb_ appears in the current release, SCOPe 2.08