Lineage for d6cjpb_ (6cjp B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (12 species)
    not a true protein
  7. 3062995Species Candida albicans [TaxId:237561] [363057] (6 PDB entries)
  8. 3062996Domain d6cjpb_: 6cjp B: [363058]
    Other proteins in same PDB: d6cjpa2
    automated match to d4xkaa_
    complexed with f5s

Details for d6cjpb_

PDB Entry: 6cjp (more details), 2.6 Å

PDB Description: candida albicans hsp90 nucleotide binding domain in complex with radicicol
PDB Compounds: (B:) Heat shock protein 90 homolog

SCOPe Domain Sequences for d6cjpb_:

Sequence, based on SEQRES records: (download)

>d6cjpb_ d.122.1.1 (B:) automated matches {Candida albicans [TaxId: 237561]}
taeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelfiriip
qkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvgfyslf
lvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedqleyleek
rikevvkkhsefvaypiqlvvtkeve

Sequence, based on observed residues (ATOM records): (download)

>d6cjpb_ d.122.1.1 (B:) automated matches {Candida albicans [TaxId: 237561]}
taeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelfiriip
qkdqkvleirdsgigmtkadlvnnlgtiakfgvgfyslflvadhvqviskhnddeqyvwe
snaggkftvtldetnerlgrgtmlrlflkedqleyleekrikevvkkhsefvaypiqlvv
tkeve

SCOPe Domain Coordinates for d6cjpb_:

Click to download the PDB-style file with coordinates for d6cjpb_.
(The format of our PDB-style files is described here.)

Timeline for d6cjpb_:

  • d6cjpb_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-05