Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:190304] [360904] (2 PDB entries) |
Domain d5zjmc1: 5zjm C:1-289 [362982] Other proteins in same PDB: d5zjma2, d5zjmb2, d5zjmc2, d5zjmd2 automated match to d3lcgb_ complexed with edo |
PDB Entry: 5zjm (more details), 2.32 Å
SCOPe Domain Sequences for d5zjmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zjmc1 c.1.10.0 (C:1-289) automated matches {Fusobacterium nucleatum [TaxId: 190304]} mkgiysalmvpynedgsinekglreiirynidkmkvdglyvggstgenfmisteekkrvf eiaideakdsvnliaqvgsinlneavelgkyvtklgykclsavtpfyykfdfseikdyye tivretgnymiiysipfltgvnmslsqfgelfenekiigvkftagdfyllervrkafpdk lifagfdemllpatvlgvdgaigstyningirakqifelaknskidealkiqhttndlie gilsnglyqtikeilklegvdagycrkpmkkisqkqiefakelhkkflk
Timeline for d5zjmc1: