SCOPe 2.07: Domain d5zjmc1: 5zjm C:1-289

Lineage for d5zjmc1 (5zjm C:1-289)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.10: Aldolase [51569] (9 families)
Common fold covers whole protein structure
Family c.1.10.0: automated matches [191319] (1 protein)
not a true family
Protein automated matches [190115] (91 species)
not a true protein
Species Fusobacterium nucleatum [TaxId:190304] [360904] (2 PDB entries)
Domain d5zjmc1: 5zjm C:1-289 [362982]
Other proteins in same PDB: d5zjma2, d5zjmb2, d5zjmc2, d5zjmd2
automated match to d3lcgb_
complexed with edo

Details for d5zjmc1

PDB Entry: 5zjm (more details), 2.32 Å

PDB Description: crystal structure of n-acetylneuraminate lyase from fusobacterium nucleatum

PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5zjmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zjmc1 c.1.10.0 (C:1-289) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
mkgiysalmvpynedgsinekglreiirynidkmkvdglyvggstgenfmisteekkrvf
eiaideakdsvnliaqvgsinlneavelgkyvtklgykclsavtpfyykfdfseikdyye
tivretgnymiiysipfltgvnmslsqfgelfenekiigvkftagdfyllervrkafpdk
lifagfdemllpatvlgvdgaigstyningirakqifelaknskidealkiqhttndlie
gilsnglyqtikeilklegvdagycrkpmkkisqkqiefakelhkkflk

SCOPe Domain Coordinates for d5zjmc1:

Click to download the PDB-style file with coordinates for d5zjmc1.
(The format of our PDB-style files is described here.)

Timeline for d5zjmc1: