SCOPe 2.08: Domain d6asvc2: 6asv C:163-313

Lineage for d6asvc2 (6asv C:163-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [362641] (1 PDB entry)

8. Domain d6asvc2: 6asv C:163-313 [362650]
   automated match to d1dkra2
   complexed with cl, po4

Details for d6asvc2

PDB Entry: 6asv, 2.21 Å

PDB Description: e. coli prpp synthetase

PDB Compounds: (C:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d6asvc2:

Sequence; same for both SEQRES and ATOM records:

>d6asvc2 c.61.1.0 (C:163-313) automated matches {Escherichia coli [TaxId: 83334]}
npivvspdiggvvraraiakllndtdmaiidkrrpranvsqvmhiigdvagrdcvlvddm
idtggtlckaaealkergakrvfayathpifsgnaannlrnsvidevvvcdtiplsdeik
slpnvrtltlsgmlaeairrisneesisamf

Timeline for d6asvc2:

• d6asvc2 first appeared in SCOPe 2.07