SCOPe 2.07: Domain d6mjaa1: 6mja A:6-185

Lineage for d6mjaa1 (6mja A:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6mjaa1: 6mja A:6-185 [362633]
   Other proteins in same PDB: d6mjaa2, d6mjab_, d6mjac1, d6mjac2, d6mjad1, d6mjad2
   automated match to d1zt4c2
   complexed with bma, fuc, gol, jtj, na, nag

Details for d6mjaa1

PDB Entry: 6mja, 2.35 Å

PDB Description: crystal structure of the mcd1d/xxo (jj294) /inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6mjaa1:

Sequence; same for both SEQRES and ATOM records:

>d6mjaa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6mjaa1:

• d6mjaa1 is new in SCOPe 2.07-stable
  
• d6mjaa1 appears in the current release, SCOPe 2.08