SCOPe 2.07: Domain d6mjad2: 6mja D:113-240

Lineage for d6mjad2 (6mja D:113-240)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6mjad2: 6mja D:113-240 [362287]
   Other proteins in same PDB: d6mjaa1, d6mjab_, d6mjac2
   automated match to d3q5ya2
   complexed with bma, fuc, gol, jtj, na, nag

Details for d6mjad2

PDB Entry: 6mja, 2.35 Å

PDB Description: crystal structure of the mcd1d/xxo (jj294) /inktcr ternary complex

PDB Compounds: (D:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjad2:

Sequence; same for both SEQRES and ATOM records:

>d6mjad2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6mjad2:

• d6mjad2 is new in SCOPe 2.07-stable
  
• d6mjad2 appears in the current release, SCOPe 2.08