Lineage for d1cnsb_ (1cns B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887018Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1887019Protein Plant class II chitinase [53957] (2 species)
  7. 1887020Species Barley (Hordeum vulgare) [TaxId:4513] [53958] (2 PDB entries)
  8. 1887023Domain d1cnsb_: 1cns B: [36242]

Details for d1cnsb_

PDB Entry: 1cns (more details), 1.91 Å

PDB Description: crystal structure of chitinase at 1.91a resolution
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d1cnsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnsb_ d.2.1.1 (B:) Plant class II chitinase {Barley (Hordeum vulgare) [TaxId: 4513]}
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa

SCOPe Domain Coordinates for d1cnsb_:

Click to download the PDB-style file with coordinates for d1cnsb_.
(The format of our PDB-style files is described here.)

Timeline for d1cnsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cnsa_