Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6mjqe2: 6mjq E:186-279 [362296] Other proteins in same PDB: d6mjqa1, d6mjqb_, d6mjqc2, d6mjqe1, d6mjqf_, d6mjqg2 automated match to d1zt4c1 complexed with bma, fuc, gol, jud, man, na, nag |
PDB Entry: 6mjq (more details), 3 Å
SCOPe Domain Sequences for d6mjqe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjqe2 b.1.1.0 (E:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d6mjqe2: