Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d6mjqe1: 6mjq E:6-185 [362295] Other proteins in same PDB: d6mjqa2, d6mjqb_, d6mjqc1, d6mjqc2, d6mjqd1, d6mjqd2, d6mjqe2, d6mjqf_, d6mjqg1, d6mjqg2, d6mjqh1, d6mjqh2 automated match to d1zt4c2 complexed with bma, fuc, gol, jud, man, na, nag |
PDB Entry: 6mjq (more details), 3 Å
SCOPe Domain Sequences for d6mjqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjqe1 d.19.1.0 (E:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d6mjqe1: