SCOPe 2.07: Domain d6mjqe1: 6mjq E:6-185

Lineage for d6mjqe1 (6mjq E:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6mjqe1: 6mjq E:6-185 [362295]
   Other proteins in same PDB: d6mjqa2, d6mjqb_, d6mjqc1, d6mjqc2, d6mjqd1, d6mjqd2, d6mjqe2, d6mjqf_, d6mjqg1, d6mjqg2, d6mjqh1, d6mjqh2
   automated match to d1zt4c2
   complexed with bma, fuc, gol, jud, man, na, nag

Details for d6mjqe1

PDB Entry: 6mjq, 3 Å

PDB Description: crystal structure of the mcd1d/xxp (jj295) /inktcr ternary complex

PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6mjqe1:

Sequence; same for both SEQRES and ATOM records:

>d6mjqe1 d.19.1.0 (E:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6mjqe1:

• d6mjqe1 is new in SCOPe 2.07-stable
  
• d6mjqe1 appears in the current release, SCOPe 2.08