Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Paenisporosarcina sp. [TaxId:1231057] [332209] (2 PDB entries) |
Domain d6ifha_: 6ifh A: [362190] automated match to d4javc_ complexed with mg |
PDB Entry: 6ifh (more details), 1.8 Å
SCOPe Domain Sequences for d6ifha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ifha_ c.23.1.0 (A:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]} mkqllivddqqgirlllnevfkregyttflaangiealdiaervkpdgvlldmkipgmdg ieilkriktrtpdvpvlmmtaygeldlikeamdlgashyftkpfdiyelrdavnemlrd
Timeline for d6ifha_: