Lineage for d6ifha_ (6ifh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 2438882Species Paenisporosarcina sp. [TaxId:1231057] [332209] (2 PDB entries)
  8. 3062128Domain d6ifha_: 6ifh A: [362190]
    automated match to d4javc_
    complexed with mg

Details for d6ifha_

PDB Entry: 6ifh (more details), 1.8 Å

PDB Description: unphosphorylated spo0f from paenisporosarcina sp. tg-14
PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d6ifha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ifha_ c.23.1.0 (A:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]}
mkqllivddqqgirlllnevfkregyttflaangiealdiaervkpdgvlldmkipgmdg
ieilkriktrtpdvpvlmmtaygeldlikeamdlgashyftkpfdiyelrdavnemlrd

SCOPe Domain Coordinates for d6ifha_:

Click to download the PDB-style file with coordinates for d6ifha_.
(The format of our PDB-style files is described here.)

Timeline for d6ifha_:

  • d6ifha_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17