SCOPe 2.07: Domain d6hm0b_: 6hm0 B:

Lineage for d6hm0b_ (6hm0 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d6hm0b_: 6hm0 B: [362178]
   automated match to d3hmeb_
   complexed with gbw

Details for d6hm0b_

PDB Entry: 6hm0, 2.4 Å

PDB Description: crystal structure of human brd9 bromodomain in complex with a protac

PDB Compounds: (B:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d6hm0b_:

Sequence; same for both SEQRES and ATOM records:

>d6hm0b_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsm

Timeline for d6hm0b_:

• d6hm0b_ is new in SCOPe 2.07-stable
  
• d6hm0b_ appears in the current release, SCOPe 2.08