SCOP 1.65: Domain d1b2sc_: 1b2s C:

Lineage for d1b2sc_ (1b2s C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (34 PDB entries)

8. Domain d1b2sc_: 1b2s C: [36215]
   Other proteins in same PDB: d1b2sd_, d1b2se_, d1b2sf_
   complexed with sul; mutant

Details for d1b2sc_

PDB Entry: 1b2s, 1.82 Å

PDB Description: structural response to mutation at a protein-protein interface

SCOP Domain Sequences for d1b2sc_:

Sequence; same for both SEQRES and ATOM records:

>d1b2sc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens}
aqvintfdgvadylqtyhklpdnyitaseaqalgwvaskgnladvapgksiggdifsnre
gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1b2sc_:

• d1b2sc_ first appeared (with stable ids) in SCOP 1.55
  
• d1b2sc_ appears in SCOP 1.63
  
• d1b2sc_ appears in SCOP 1.67
  
• d1b2sc_ appears in the current release, SCOPe 2.08