Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) |
Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) |
Protein Barstar (barnase inhibitor) [52040] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) |
Domain d1b2sf_: 1b2s F: [30839] Other proteins in same PDB: d1b2sa_, d1b2sb_, d1b2sc_ complexed with sul; mutant |
PDB Entry: 1b2s (more details), 1.82 Å
SCOP Domain Sequences for d1b2sf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2sf_ c.9.1.1 (F:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens} kkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqsk qltengaesvlqvfreakaegcditiils
Timeline for d1b2sf_: