Lineage for d6c07b2 (6c07 B:131-259)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583034Species Cryptosporidium parvum [TaxId:353152] [362018] (1 PDB entry)
  8. 2583039Domain d6c07b2: 6c07 B:131-259 [362136]
    automated match to d4odja2
    complexed with cl, k, mg

Details for d6c07b2

PDB Entry: 6c07 (more details), 1.85 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase (metk/mat) from cryptosporidium parvum
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6c07b2:

Sequence, based on SEQRES records: (download)

>d6c07b2 d.130.1.0 (B:131-259) automated matches {Cryptosporidium parvum [TaxId: 353152]}
nvedigagdqgmmfgyatnetkelmplthvlatsitreldyirvkgvssrvgwlrpdgka
qvtveynckhgvlipkrihtilvsvqhdenieneeirefvlenvikkvcpsdlmdketri
linpsgrft

Sequence, based on observed residues (ATOM records): (download)

>d6c07b2 d.130.1.0 (B:131-259) automated matches {Cryptosporidium parvum [TaxId: 353152]}
nvedigagdqgmmfgyatnetkelmplthvlatsitreldyirvkgwlrpdgkaqvtvey
nckhgvlipkrihtilvsvqhdenieneeirefvlenvikkvcpsdlmdketrilinpsg
rft

SCOPe Domain Coordinates for d6c07b2:

Click to download the PDB-style file with coordinates for d6c07b2.
(The format of our PDB-style files is described here.)

Timeline for d6c07b2: