Lineage for d1bsda_ (1bsd A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323019Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 323020Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 323021Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins)
  6. 323022Protein Barnase [81305] (1 species)
  7. 323023Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (34 PDB entries)
  8. 323106Domain d1bsda_: 1bsd A: [36200]

Details for d1bsda_

PDB Entry: 1bsd (more details), 2.3 Å

PDB Description: crystal structural analysis of mutations in the hydrophobic cores of barnase

SCOP Domain Sequences for d1bsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsda_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwlvykttdhyqtftkir

SCOP Domain Coordinates for d1bsda_:

Click to download the PDB-style file with coordinates for d1bsda_.
(The format of our PDB-style files is described here.)

Timeline for d1bsda_: