SCOP 1.67: Domain d1bsda_: 1bsd A:

Lineage for d1bsda_ (1bsd A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (34 PDB entries)

8. Domain d1bsda_: 1bsd A: [36200]

Details for d1bsda_

PDB Entry: 1bsd, 2.3 Å

PDB Description: crystal structural analysis of mutations in the hydrophobic cores of barnase

SCOP Domain Sequences for d1bsda_:

Sequence; same for both SEQRES and ATOM records:

>d1bsda_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwlvykttdhyqtftkir

Timeline for d1bsda_:

• d1bsda_ first appeared (with stable ids) in SCOP 1.55
  
• d1bsda_ appears in SCOP 1.65
  
• d1bsda_ appears in SCOP 1.69
  
• d1bsda_ appears in the current release, SCOPe 2.08