Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255782] (6 PDB entries) |
Domain d6i5ma2: 6i5m A:207-320 [361988] Other proteins in same PDB: d6i5ma1, d6i5ma3 automated match to d4m53a2 protein/RNA complex; complexed with fmt, gdp, mg, na |
PDB Entry: 6i5m (more details), 2.4 Å
SCOPe Domain Sequences for d6i5ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5ma2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d6i5ma2: