Lineage for d5zeca_ (5zec A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849242Species Vanderwaltozyma polyspora [TaxId:436907] [361945] (4 PDB entries)
  8. 2849245Domain d5zeca_: 5zec A: [361958]
    automated match to d4pvca_
    complexed with edo, eoh, gol, ipa, nap, peg; mutant

Details for d5zeca_

PDB Entry: 5zec (more details), 1.78 Å

PDB Description: crystal structure of kluyveromyces polyspora adh (kpadh) mutant (q136n/f161v/s196g/e214g/s237c)
PDB Compounds: (A:) Uncharacterized protein ADH

SCOPe Domain Sequences for d5zeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zeca_ c.2.1.0 (A:) automated matches {Vanderwaltozyma polyspora [TaxId: 436907]}
msvlisgasgyiakhivrvlleqnykvigtvrsqdkadkllkqynnpnlsyeivpeianl
dafddifkkhgkeikyvihaaspvnfgakdlekdlvipaingtknmfeaikkyapdtver
vvmtasyasimtphrnndptltldeetwnpvteenayenvvtaycasktfaekeawkfvk
ensdavkfklttihpgfvfgpqnfdedvtkklngtceiingllhapfdtkvekthfcqfi
dvrdvakthvlgfqkdelinqrlllcngafsqqdivnvfnedfpelkgqfppedkdtdln
kgvtgckidnektkkllafeftpfhktihdtvyqilhkegrv

SCOPe Domain Coordinates for d5zeca_:

Click to download the PDB-style file with coordinates for d5zeca_.
(The format of our PDB-style files is described here.)

Timeline for d5zeca_: