SCOPe 2.07: Domain d6hm2c1: 6hm2 C:30-341

Lineage for d6hm2c1 (6hm2 C:30-341)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries)

8. Domain d6hm2c1: 6hm2 C:30-341 [361756]
   Other proteins in same PDB: d6hm2a2, d6hm2b2, d6hm2c2, d6hm2d2, d6hm2e2
   automated match to d5l9sa_
   complexed with edo, g9z, na

Details for d6hm2c1

PDB Entry: 6hm2, 1.74 Å

PDB Description: structure in p1 form of the pbp agtb in complex with agropinic acid from a.tumefacien r10

PDB Compounds: (C:) Agropine permease

SCOPe Domain Sequences for d6hm2c1:

Sequence; same for both SEQRES and ATOM records:

>d6hm2c1 c.94.1.0 (C:30-341) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]}
adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae
spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq
ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas
diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf
infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny
davkaewttyim

Timeline for d6hm2c1:

• d6hm2c1 is new in SCOPe 2.07-stable
  
• d6hm2c1 appears in the current release, SCOPe 2.08