Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries) |
Domain d6hm2c1: 6hm2 C:30-341 [361756] Other proteins in same PDB: d6hm2a2, d6hm2b2, d6hm2c2, d6hm2d2, d6hm2e2 automated match to d5l9sa_ complexed with edo, g9z, na |
PDB Entry: 6hm2 (more details), 1.74 Å
SCOPe Domain Sequences for d6hm2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hm2c1 c.94.1.0 (C:30-341) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]} adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny davkaewttyim
Timeline for d6hm2c1: