Lineage for d6hm2c1 (6hm2 C:30-341)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (149 species)
    not a true protein
  7. 3061605Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries)
  8. 3061694Domain d6hm2c1: 6hm2 C:30-341 [361756]
    Other proteins in same PDB: d6hm2a2, d6hm2b2, d6hm2c2, d6hm2d2, d6hm2e2
    automated match to d5l9sa_
    complexed with edo, g9z, na

Details for d6hm2c1

PDB Entry: 6hm2 (more details), 1.74 Å

PDB Description: structure in p1 form of the pbp agtb in complex with agropinic acid from a.tumefacien r10
PDB Compounds: (C:) Agropine permease

SCOPe Domain Sequences for d6hm2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hm2c1 c.94.1.0 (C:30-341) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]}
adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae
spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq
ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas
diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf
infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny
davkaewttyim

SCOPe Domain Coordinates for d6hm2c1:

Click to download the PDB-style file with coordinates for d6hm2c1.
(The format of our PDB-style files is described here.)

Timeline for d6hm2c1:

  • d6hm2c1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27