Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [338697] (3 PDB entries) |
Domain d6c3ud_: 6c3u D: [361625] automated match to d5v91a_ complexed with gol, mn, ny2 |
PDB Entry: 6c3u (more details), 1.85 Å
SCOPe Domain Sequences for d6c3ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c3ud_ d.32.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]} mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla qrlaacreqpykgmvff
Timeline for d6c3ud_: