SCOPe 2.08: Domain d6h9bc2: 6h9b C:246-440

Lineage for d6h9bc2 (6h9b C:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)

8. Domain d6h9bc2: 6h9b C:246-440 [361422]
   Other proteins in same PDB: d6h9ba1, d6h9bb1, d6h9bc1, d6h9bd1, d6h9be_
   automated match to d1tuba2
   complexed with fwh, gdp, gtp, mg, so4

Details for d6h9bc2

PDB Entry: 6h9b, 2.75 Å

PDB Description: 1,1-diheterocyclic ethylenes derived from quinaldine and carbazole as new tubulin polymerization inhibitors: synthesis, metabolism, and biological evaluation

PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d6h9bc2:

Sequence; same for both SEQRES and ATOM records:

>d6h9bc2 d.79.2.1 (C:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d6h9bc2:

• d6h9bc2 first appeared in SCOPe 2.07