Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Enterovirus d68 [TaxId:42789] [269068] (15 PDB entries) |
Domain d6csga_: 6csg A: [361359] automated match to d4wm8a_ |
PDB Entry: 6csg (more details), 2.17 Å
SCOPe Domain Sequences for d6csga_:
Sequence, based on SEQRES records: (download)
>d6csga_ b.121.4.0 (A:) automated matches {Enterovirus d68 [TaxId: 42789]} iesiiktatdtvkseinaelgvvpslnavetgatsntepeeaiqtrtvinqhgvsetlve nflsraalvskrsfeykdhtsstaradknffkwtintrsfvqlrrklelftylrfdaeit ilttvavngsgnntyvglpdltlqamfvptgaltpekqdsfhwqsgsnasvffkisdppa ritipfmcinsaysvfydgfagfeknglyginpadtignlcvrivnehqpvgftvtvrvy mkpkhikawaprpprtlpymsiananykgkerapnalsaiignrdsvktmphnivn
>d6csga_ b.121.4.0 (A:) automated matches {Enterovirus d68 [TaxId: 42789]} iesiiktatdtvkseinaelgvvpslnavetgatsntepeeaiqtrtvinqhgvsetlve nflsraalvskrsfeykdhtsstadknffkwtintrsfvqlrrklelftylrfdaeitil ttvavngyvglpdltlqamfvptgaltpekqdsfhwqsgsnasvffkisdpparitipfm cinsaysvfydgfagfeknglyginpadtignlcvrivnehqpvgftvtvrvymkpkhik awaprpprtlpymsiananykgkerapnalsaiignrdsvktmphnivn
Timeline for d6csga_: