Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [361356] (1 PDB entry) |
Domain d6bveb_: 6bve B: [361357] automated match to d4y9ab_ complexed with na, pga |
PDB Entry: 6bve (more details), 1.78 Å
SCOPe Domain Sequences for d6bveb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bveb_ c.1.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]} mrkiiiagnwkmhktqaeaqaflqgfkpliedaaesrevvlcvpftdlsgmsqqlhggrv rlgaqnvhweasgaytgeisaamlteigihyvvighserrqyfgetdetanlrvlaaqka glipilcvgeskaqrdageteqvivdqvkkglvnvdqsnlviayepiwaigtgdtcaate anrviglireqltnsqvtiqyggsvnannvdeimaqpeidgalvggaslepqsfarivnf qp
Timeline for d6bveb_: