Lineage for d6bveb_ (6bve B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413631Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2413632Protein automated matches [190605] (23 species)
    not a true protein
  7. 3061294Species Synechocystis sp. [TaxId:1111708] [361356] (1 PDB entry)
  8. 3061295Domain d6bveb_: 6bve B: [361357]
    automated match to d4y9ab_
    complexed with na, pga

Details for d6bveb_

PDB Entry: 6bve (more details), 1.78 Å

PDB Description: triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d6bveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bveb_ c.1.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mrkiiiagnwkmhktqaeaqaflqgfkpliedaaesrevvlcvpftdlsgmsqqlhggrv
rlgaqnvhweasgaytgeisaamlteigihyvvighserrqyfgetdetanlrvlaaqka
glipilcvgeskaqrdageteqvivdqvkkglvnvdqsnlviayepiwaigtgdtcaate
anrviglireqltnsqvtiqyggsvnannvdeimaqpeidgalvggaslepqsfarivnf
qp

SCOPe Domain Coordinates for d6bveb_:

Click to download the PDB-style file with coordinates for d6bveb_.
(The format of our PDB-style files is described here.)

Timeline for d6bveb_:

  • d6bveb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20