SCOPe 2.07: Domain d5yxua1: 5yxu A:2-114

Lineage for d5yxua1 (5yxu A:2-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5yxua1: 5yxu A:2-114 [361213]
   Other proteins in same PDB: d5yxua2, d5yxub2, d5yxuc1, d5yxud_, d5yxue1, d5yxue3, d5yxuf2, d5yxug2, d5yxuh_
   automated match to d4mayc1

Details for d5yxua1

PDB Entry: 5yxu, 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav

PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxua1:

Sequence; same for both SEQRES and ATOM records:

>d5yxua1 b.1.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtvtqsqpemsvqeaetvtlsctydtsendyilfwykqppsrqmilvirqeaykqqnat
enrfsvnfqkaaksfslkisdsqlgdaamyfcaygeddkiifgkgtrlhilpn

Timeline for d5yxua1:

• d5yxua1 is new in SCOPe 2.07-stable
  
• d5yxua1 appears in the current release, SCOPe 2.08