Lineage for d5yxua1 (5yxu A:2-114)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1104 PDB entries)
  8. 3061151Domain d5yxua1: 5yxu A:2-114 [361213]
    Other proteins in same PDB: d5yxua2, d5yxub2, d5yxuc1, d5yxud_, d5yxue1, d5yxue3, d5yxuf2, d5yxug2, d5yxuh_
    automated match to d4mayc1

Details for d5yxua1

PDB Entry: 5yxu (more details), 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxua1 b.1.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtvtqsqpemsvqeaetvtlsctydtsendyilfwykqppsrqmilvirqeaykqqnat
enrfsvnfqkaaksfslkisdsqlgdaamyfcaygeddkiifgkgtrlhilpn

SCOPe Domain Coordinates for d5yxua1:

Click to download the PDB-style file with coordinates for d5yxua1.
(The format of our PDB-style files is described here.)

Timeline for d5yxua1:

  • d5yxua1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13