SCOP 1.57: Domain d1rls__: 1rls -

Lineage for d1rls__ (1rls -)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)

8. Domain d1rls__: 1rls - [36095]

Details for d1rls__

PDB Entry: 1rls, 1.9 Å

PDB Description: crystal structure of rnase t1 complexed with the product nucleotide 3'-gmp. structural evidence for direct interaction of histidine 40 and glutamic acid 58 with the 2'-hydroxyl group of ribose

SCOP Domain Sequences for d1rls__:

Sequence; same for both SEQRES and ATOM records:

>d1rls__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1rls__:

• d1rls__ first appeared (with stable ids) in SCOP 1.55
  
• d1rls__ appears in SCOP 1.59
  
• d1rls__ appears in the current release, SCOPe 2.08, called d1rlsa_