Lineage for d2aae__ (2aae -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries) 
Domain d2aae__: 2aae - [36066]
Details for d2aae__
PDB Entry: 2aae (more details), 1.8 Å
PDB Description: the role of histidine-40 in ribonuclease t1 catalysis: three- dimensional structures of the partially active his40lys mutant
SCOP Domain Sequences for d2aae__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aae__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsypkkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d2aae__:
Click to download the PDB-style file with coordinates for d2aae__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aae__:
- d2aae__ first appeared (with stable ids) in SCOP 1.55
- d2aae__ appears in SCOP 1.59
- d2aae__ appears in the current release, SCOPe 2.08, called d2aaea_
View in 3D