![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Family c.95.1.2: Chalcone synthase [53914] (2 proteins) |
![]() | Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species) |
![]() | Species Gerbera hybrida [53918] (2 PDB entries) |
![]() | Domain d1ee0b2: 1ee0 B:236-394 [36010] |
PDB Entry: 1ee0 (more details), 2.05 Å
SCOP Domain Sequences for d1ee0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee0b2 c.95.1.2 (B:236-394) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrida} averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvrv
Timeline for d1ee0b2: