Lineage for d1ee0b2 (1ee0 B:236-394)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75664Family c.95.1.2: Chalcone synthase [53914] (2 proteins)
  6. 75689Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species)
  7. 75690Species Gerbera hybrida [53918] (2 PDB entries)
  8. 75694Domain d1ee0b2: 1ee0 B:236-394 [36010]

Details for d1ee0b2

PDB Entry: 1ee0 (more details), 2.05 Å

PDB Description: 2-pyrone synthase complexed with acetoacetyl-coa

SCOP Domain Sequences for d1ee0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee0b2 c.95.1.2 (B:236-394) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrida}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvrv

SCOP Domain Coordinates for d1ee0b2:

Click to download the PDB-style file with coordinates for d1ee0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ee0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee0b1