SCOPe 2.02: Domain d1cmla2: 1cml A:236-389

Lineage for d1cmla2 (1cml A:236-389)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
   Uniprot P30074

8. Domain d1cmla2: 1cml A:236-389 [35990]
   complexed with mlc, pin, so4

Details for d1cmla2

PDB Entry: 1cml, 1.69 Å

PDB Description: chalcone synthase from alfalfa complexed with malonyl-coa

PDB Compounds: (A:) protein (chalcone synthase)

SCOPe Domain Sequences for d1cmla2:

Sequence; same for both SEQRES and ATOM records:

>d1cmla2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1cmla2:

• d1cmla2 first appeared (with stable ids) in SCOP 1.55
  
• d1cmla2 appears in SCOPe 2.01
  
• d1cmla2 appears in SCOPe 2.03
  
• d1cmla2 appears in the current release, SCOPe 2.08