Class b: All beta proteins [48724] (178 folds) |
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) |
Family b.105.1.0: automated matches [231757] (1 protein) not a true family |
Protein automated matches [231758] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [352204] (11 PDB entries) |
Domain d6c3ka2: 6c3k A:316-383 [359784] Other proteins in same PDB: d6c3ka1, d6c3kb1 automated match to d3huma2 complexed with cl, na, zn; mutant |
PDB Entry: 6c3k (more details), 1.6 Å
SCOPe Domain Sequences for d6c3ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c3ka2 b.105.1.0 (A:316-383) automated matches {Staphylococcus aureus [TaxId: 93062]} kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg pptvevhq
Timeline for d6c3ka2: