Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) |
Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species) |
Species Escherichia coli [TaxId:562] [53913] (9 PDB entries) |
Domain d1hn9a2: 1hn9 A:175-317 [35978] complexed with po4 |
PDB Entry: 1hn9 (more details), 2 Å
SCOPe Domain Sequences for d1hn9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hn9a2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik pgqlvlleafgggftwgsalvrf
Timeline for d1hn9a2: