Lineage for d6frmb2 (6frm B:256-408)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465288Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)
  8. 2465304Domain d6frmb2: 6frm B:256-408 [359712]
    Other proteins in same PDB: d6frma1, d6frmb1, d6frmc1, d6frmd1, d6frme1, d6frmf1, d6frmg1, d6frmh1
    automated match to d2ohha2
    complexed with 7mt, cl, fe, fmn, tb

Details for d6frmb2

PDB Entry: 6frm (more details), 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4
PDB Compounds: (B:) Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4

SCOPe Domain Sequences for d6frmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frmb2 c.23.5.0 (B:256-408) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemk

SCOPe Domain Coordinates for d6frmb2:

Click to download the PDB-style file with coordinates for d6frmb2.
(The format of our PDB-style files is described here.)

Timeline for d6frmb2: