Lineage for d6frmh1 (6frm H:1-255)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603824Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries)
  8. 2603846Domain d6frmh1: 6frm H:1-255 [359685]
    Other proteins in same PDB: d6frma2, d6frmb2, d6frmc2, d6frmd2, d6frme2, d6frmf2, d6frmg2, d6frmh2
    automated match to d2ohha1
    complexed with 7mt, cl, fe, fmn, tb

Details for d6frmh1

PDB Entry: 6frm (more details), 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4
PDB Compounds: (H:) Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4

SCOPe Domain Sequences for d6frmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frmh1 d.157.1.0 (H:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

SCOPe Domain Coordinates for d6frmh1:

Click to download the PDB-style file with coordinates for d6frmh1.
(The format of our PDB-style files is described here.)

Timeline for d6frmh1: