Lineage for d6eq2a_ (6eq2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971310Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2971311Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. 2971399Domain d6eq2a_: 6eq2 A: [359557]
    automated match to d1irya_
    protein/DNA complex; complexed with bu8

    has additional insertions and/or extensions that are not grouped together

Details for d6eq2a_

PDB Entry: 6eq2 (more details), 1.8 Å

PDB Description: mth1 in complex with fragment 6
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6eq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eq2a_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6eq2a_:

Click to download the PDB-style file with coordinates for d6eq2a_.
(The format of our PDB-style files is described here.)

Timeline for d6eq2a_: