Lineage for d1dlvc1 (1dlv C:4-268)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186522Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 1186791Protein Biosynthetic thiolase [53905] (1 species)
  7. 1186792Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries)
    Uniprot P07097
  8. 1186885Domain d1dlvc1: 1dlv C:4-268 [35928]
    complexed with coa, so4

Details for d1dlvc1

PDB Entry: 1dlv (more details), 2.29 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with coa
PDB Compounds: (C:) biosynthetic thiolase

SCOPe Domain Sequences for d1dlvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlvc1 c.95.1.1 (C:4-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1dlvc1:

Click to download the PDB-style file with coordinates for d1dlvc1.
(The format of our PDB-style files is described here.)

Timeline for d1dlvc1: