SCOPe 2.07: Domain d6ejxd_: 6ejx D:

Lineage for d6ejxd_ (6ejx D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)

7. Species Mus musculus [TaxId:10090] [359229] (1 PDB entry)

8. Domain d6ejxd_: 6ejx D: [359230]
   automated match to d1m10b_
   complexed with gol, imd, mes, peg, pol

Details for d6ejxd_

PDB Entry: 6ejx, 2 Å

PDB Description: the metal ion-dependent adhesion site (midas) of the alphambeta2 integrin mac-1 i-domain promiscuously and competitively binds multiple ligands in the regulation of leukocyte function

PDB Compounds: (D:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d6ejxd_:

Sequence; same for both SEQRES and ATOM records:

>d6ejxd_ c.10.2.7 (D:) von Willebrand factor binding domain of glycoprotein Ib alpha {Mus musculus [TaxId: 10090]}
sqhtcsiskvtsllevncenkkltalpadlpadtgilhlgenqlgtfstaslvhfthlty
lyldrceltslqtngkliklenldlshnnlkslpslgwalpalttldvsfnklgslspgv
ldglsqlqelylqnndlkslppglllpttklkklnlannklrelpsglldgledldtlyl
qrnwlrtipkgffgtlllpfvflhanswycdceilyfrhwlqenannvylwkqgvdvkdt
tpnvasvrcanldnapvysypgkgcp

Timeline for d6ejxd_:

• d6ejxd_ is new in SCOPe 2.07-stable
  
• d6ejxd_ appears in the current release, SCOPe 2.08